CJC 1295 CAS 863288-34-0 mit gutem Preis

Produktname: CJC1295
CAS: 863288-34-0
MF: C152H252N44O42
MW: 3367.89688
EINECS: 206-141-6
Mol Datei: 863288-34-0.mol

CJC 1295 CAS 863288-34-0 mit gutem Preis

Produktname: CJC1295
Synonyme: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl- L-Threonyl-L-Glutaminyl-L-Seryl-L-Tyrosyl-L-Arginyl-L-Lysyl-L-Valyl-L-Leucyl-L-Alanyl-L-Glutaminyl-L-Seryl-L-Alanyl-L- Arginyl-L-Lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-Aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5- Dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamid;CJC-1295 CJC-1295;CJC-1295 Acetat;CJC1295 ohne DAC;-L-Arginyl-L- Lysyl-L-leucyl-L-leucyl-L-glutaminyl;L-Tyrosyl-D-Alanyl-L-α-Aspartyl-L-Alanyl-L-Isoleucyl-L-Phenylalanyl-L-Allothreonyl-L-Glutaminyl-L- Seryl-L-Tyrosyl-L-Arginyl-L-Lysyl-L-Valyl-L-Leucyl-L-Alanyl-L-Glutaminyl-L-Leucyl-L-Seryl-L-Alanyl
CAS: 863288-34- 0
MF: C152H252N44O42
MW: 3367.89688
EINECS: 206-141-6
Produktkategorien: Peptide;CJC
Mol Datei: 863288-34-0.mol
<& >Cjc-1295 ist ein synthetisches GHRH-Analogon (Wachstumshormon-Releasing-Hormon) bestehend aus 30 Aminosäuren. Es wurde festgestellt, dass CJC-1295 bei der Erhöhung der Wachstumshormonsekretion und von IGF-1 hochwirksam ist, ohne das Pulsieren der GH-Sekretion negativ zu beeinflussen. Die Hauptanwendung von CJC-1295 besteht darin, erhöhte GH-Spiegel bereitzustellen, was auch zu erhöhten IGF-1-Spiegeln führt. CJC1295 ohne DAC-Version kann auch als Mod GRF 1-29 bezeichnet werden. Die Wirkungszeit ist relativ kurz und wird vom Körper bald verstoffwechselt.

Vorteile von CJC1295 CAS 863288-34-0
Gewichtszunahme
Erhöht das Muskelwachstum
Reduziert das Fett<& >Erhöht die Zellreparatur und -regeneration
Fördert den Schlaf
Stärkt das Immunsystem und die Knochendichte
CJC-1-'2-'9-'5 fördert auch den Slow-Wave-Tiefschlaf, der für das höchste Maß an Muskelwachstum und Gedächtniserhaltung und -verjüngung

Verwendung von CJC1295
CJC 1295 Acetat wird bei der Anwendung von Wachstumshormon-Releasing-Hormon-Agonisten zur Herstellung von Anti-Aging-Mitteln verwendet.

Reviews

There are no reviews yet.

Be the first to review “CJC 1295 CAS 863288-34-0 mit gutem Preis”

Your email address will not be published. Required fields are marked *